Rabbit Polyclonal Anti-TBX6 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX6 antibody: synthetic peptide directed towards the middle region of human TBX6. Synthetic peptide located within the following region: PSHLPTRSPSFPEAPDSGRSAPYSAAFLELPHGSGGSGYPAAPPAVPFAP |
Rabbit polyclonal TBX6 Antibody (Center W158)
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TBX6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the Central region of human TBX6. |
Rabbit polyclonal TBX6 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TBX6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 264-293 amino acids from the Central region of human TBX6. |
Rabbit Polyclonal Anti-TBX6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX6 Antibody: synthetic peptide directed towards the N terminal of human TBX6. Synthetic peptide located within the following region: AHPPLPLLPPAMGTEPAPSAPEALHSLPGVSLSLENRELWKEFSSVGTEM |
TBX6 Rabbit Polyclonal (aa361-377) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TBX6 antibody was raised against synthetic peptide from human TBX6. |
Rabbit Polyclonal Anti-TBX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX6 Antibody: synthetic peptide directed towards the middle region of human TBX6. Synthetic peptide located within the following region: AKGFRENGRNCKRERDARVKRKLRGPEPAATEAYGSGDTPGGPCDSTLGG |
Rabbit Polyclonal Anti-TBX6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX6 Antibody: synthetic peptide directed towards the N terminal of human TBX6. Synthetic peptide located within the following region: AHPPLPLLPPAMGTEPAPSAPEALHSLPGVSLSLENRELWKEFSSVGTEM |
TBX6 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TBX6 |
TBX6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 191-300 of human TBX6 (NP_004599.2). |
Germany
Japan
United Kingdom
China
