Antibodies

View as table Download

Rabbit anti-TBXAS1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TBXAS1

Rabbit polyclonal anti-THAS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human THAS.

TBXAS1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 234-266 amino acids from the Central region of Human CYP5A1.

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP

TBXAS Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A12

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700230

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV

TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1H9

Applications LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700230

TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI2C1

Applications LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700233

TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1C3

Applications LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700233

TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1H1

Applications LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700230

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TBXAS1

TBXAS1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TBXAS1

Thromboxane synthase Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 355-534 of human Thromboxane synthase (NP_001052.2).
Modifications Unmodified

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), Biotinylated

Applications FC, IF, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), HRP conjugated

Applications FC, IF, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TBXAS biotinylated detection antibody, Luminex validated mouse monoclonal antibody, clone OTI2C1

Applications LMNX
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600230

TBXAS biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI1B8

Applications ELISA, LMNX
Reactivities Human
Conjugation Biotin
Matched ELISA Pair TA600230