Rabbit anti-TBXAS1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBXAS1 |
Rabbit anti-TBXAS1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBXAS1 |
Rabbit polyclonal anti-THAS antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human THAS. |
TBXAS1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 234-266 amino acids from the Central region of Human CYP5A1. |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP |
TBXAS Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A12
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700230 |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV |
TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1H9
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700230 |
TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI2C1
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700233 |
TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1C3
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700233 |
TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1H1
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700230 |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TBXAS1 |
TBXAS1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TBXAS1 |
Thromboxane synthase Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 355-534 of human Thromboxane synthase (NP_001052.2). |
Modifications | Unmodified |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 399.00
2 Weeks
TBXAS biotinylated detection antibody, Luminex validated mouse monoclonal antibody, clone OTI2C1
Applications | LMNX |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600230 |
USD 399.00
2 Weeks
TBXAS biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI1B8
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600230 |