TC2N (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 9~39 amino acids from the N-terminal region of human TAC2N |
TC2N (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 9~39 amino acids from the N-terminal region of human TAC2N |
Rabbit Polyclonal Anti-TC2N Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TC2N antibody: synthetic peptide directed towards the middle region of human TC2N. Synthetic peptide located within the following region: SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ |