Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Transcription Factor 3 / E2A (Thr355) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human E2A around the phosphorylation site of threonine 355 (P-S-TP-P-V). |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against TCF3 / ITF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KAPRARTSPDEDED, from the internal region of the protein sequence according to NP_003191.1. |
Rabbit polyclonal anti-Transcription Factor 3 (E2A Immunoglobulin Enhancer Binding Factors E12/E47) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human E2A. |
Rabbit Polyclonal anti-Tcf3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tcf3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Tcf3. Synthetic peptide located within the following region: ARERLRVRDINEAFKELGRMCQLHLSTEKPQTKLLILHQAVAVILSLEQQ |
Rabbit Polyclonal Anti-TCF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the C terminal of human TCF3. Synthetic peptide located within the following region: EENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVAN |
Rabbit Polyclonal Anti-TCF3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF3 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF3. Synthetic peptide located within the following region: EDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGG |
Rabbit Polyclonal Anti-TCF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF3 antibody: synthetic peptide directed towards the N terminal of human TCF3. Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL |
TCF3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TCF3 |
TCF3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TCF3 |
| Modifications | Unmodified |
Active filters
Target Symbol
- TCF3