Germany
Japan
United Kingdom
China
Rabbit Polyclonal ETS1 associated protein II Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to residues 11-28 (REAAEEEGEPEVKKRRLL) of human EAPII. |
Antibodies
View as table Download
Rabbit polyclonal EAPII Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EAPII antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-272 amino acids from the C-terminal region of human EAPII. |
Rabbit Polyclonal Anti-TTRAP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TTRAP Antibody: synthetic peptide directed towards the middle region of human TTRAP. Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK |
USD 465.00
4 Weeks
TDP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TDP2 (NP_057698.2). |
| Modifications | Unmodified |
USD 379.00
In Stock
TDP2 mouse monoclonal antibody,clone OTI3G10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Active filters
Target Symbol
- TDP2