Rabbit Polyclonal Anti-TEAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the C terminal of human TEAD1. Synthetic peptide located within the following region: YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK |
Rabbit polyclonal anti-TEAD1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TEAD1. |
Rabbit Polyclonal anti-TEAD1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the middle region of human TEAD1. Synthetic peptide located within the following region: PASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGH |
Rabbit Polyclonal Anti-TEAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the N terminal of human TEAD1. Synthetic peptide located within the following region: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY |
TEAD1 Rabbit polyclonal Antibody
| Applications | ChIP, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2). |
| Modifications | Unmodified |
TEAD1 Rabbit polyclonal Antibody
| Applications | ChIP, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
