Germany
Japan
United Kingdom
China
Goat Anti-ETF-4 / TEAD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPPDAVDSYQRH, from the internal region of the protein sequence according to NP_003589.1. |
Antibodies
View as table Download
TEAD2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TEAD2 |
Rabbit Polyclonal Anti-TEAD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD2 antibody: synthetic peptide directed towards the N terminal of human TEAD2. Synthetic peptide located within the following region: GEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQ |
Rabbit Polyclonal anti-TEAD2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD2 antibody: synthetic peptide directed towards the middle region of human TEAD2. Synthetic peptide located within the following region: SGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVY |
TEAD2 Antibody - N-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse TEAD2 |
TEAD2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TEAD2 |
TEAD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TEAD2 |
| Modifications | Unmodified |
TEAD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human TEAD2. |
| Modifications | Unmodified |
Active filters
Target Symbol
- TEAD2