Rabbit Polyclonal Anti-TEAD3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD3 antibody: synthetic peptide directed towards the C terminal of human TEAD3. Synthetic peptide located within the following region: MMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD |
Rabbit polyclonal anti-TEAD3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TEAD3. |
Rabbit Polyclonal Anti-TEAD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD3 antibody: synthetic peptide directed towards the N terminal of human TEAD3. Synthetic peptide located within the following region: MASNSWNASSSPGEAREDGPEGLDKGLDNDAEGVWSPDIEQSFQEALAIY |
Rabbit Polyclonal Anti-TEAD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TEAD3 Antibody: synthetic peptide directed towards the middle region of human TEAD3. Synthetic peptide located within the following region: GLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTIS |
Rabbit Polyclonal Anti-TEAD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD3 antibody: synthetic peptide directed towards the middle region of human TEAD3. Synthetic peptide located within the following region: KFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPL |
TEAD3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TEAD3 |
TEAD3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-330 of human TEAD3 (NP_003205.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
