Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TEAD4 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TEAD4 Antibody: synthetic peptide directed towards the middle region of human TEAD4. Synthetic peptide located within the following region: LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEK |
Rabbit Polyclonal Anti-TEAD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEAD4 antibody: synthetic peptide directed towards the C terminal of human TEAD4. Synthetic peptide located within the following region: MMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
Rabbit Polyclonal Anti-TEAD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TEAD4 antibody is: synthetic peptide directed towards the N-terminal region of Human TEAD4. Synthetic peptide located within the following region: TAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQE |
TEAD4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TEAD4