Rabbit polyclonal TEC Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TEC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 175-205 amino acids from the Central region of human TEC. |
Rabbit Polyclonal Anti-TEFM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TEFM Antibody is: synthetic peptide directed towards the N-terminal region of Human TEFM. Synthetic peptide located within the following region: RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ |
Rabbit Polyclonal Anti-TEC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TEC antibody: synthetic peptide directed towards the middle region of human TEC. Synthetic peptide located within the following region: VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG |
TEC (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 25-55 amino acids from the N-terminal region of Human TEC |
TEC Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TEC |
TEC Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human TEC (NP_003206.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
