Antibodies

View as table Download

Rabbit Polyclonal Anti-TEFM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TEFM Antibody is: synthetic peptide directed towards the N-terminal region of Human TEFM. Synthetic peptide located within the following region: NLESLMNVPLFKYKSTVQVCNSILCPKTGREKRKSPENRFLRKLLKPDIE

TEFM Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 36-210 of human TEFM (NP_078959.3).
Modifications Unmodified