Antibodies

Jump to Filters
View as table Download
TENT5C Rabbit Polyclonal Antibody
TA335539

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-FAM46C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM46C Antibody: synthetic peptide directed towards the middle region of human FAM46C. Synthetic peptide located within the following region: LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP
TENT5C Rabbit Polyclonal Antibody
TA366254

USD 380.00

4 Weeks

TENT5C rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TENT5C
TENT5C Rabbit Polyclonal Antibody
TA370604

USD 380.00

4 Weeks

TENT5C rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TENT5C