TFAP2A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TFAP2A |
TFAP2A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TFAP2A |
Rabbit Polyclonal Anti-AP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AP-2 Antibody: A synthesized peptide derived from human AP-2 |
Rabbit polyclonal anti-AP-2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human AP-2. |
Rabbit Polyclonal Anti-TFAP2A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFAP2A antibody: synthetic peptide directed towards the C terminal of human TFAP2A. Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS |
TFAP2A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP2A |
TFAP2A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TFAP2A |
TFAP2A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TFAP2A |
TFAP2A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TFAP2A |
TFAP2A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TFAP2A |
Activator protein 2 (AP-2/TFAP2A) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-437 of human Activator protein 2 (AP-2/Activator protein 2 (AP-2/TFAP2A)) (NP_001027451.1). |
| Modifications | Unmodified |