Rabbit Polyclonal Anti-TFAP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFAP4 Antibody: synthetic peptide directed towards the C terminal of human TFAP4. Synthetic peptide located within the following region: EEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP |
Rabbit polyclonal TFAP4 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TFAP4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 125-154 amino acids from the Central region of human TFAP4. |
Rabbit Polyclonal Anti-TFAP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFAP4 Antibody: synthetic peptide directed towards the C terminal of human TFAP4. Synthetic peptide located within the following region: TSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTA |
Rabbit Polyclonal Anti-Tcfap4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Tcfap4 antibody: synthetic peptide directed towards the middle region of mouse Tcfap4. Synthetic peptide located within the following region: AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPT |
Rabbit Polyclonal Anti-TCFAP4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-TCFAP4 antibody: synthetic peptide directed towards the middle region of mouse TCFAP4. Synthetic peptide located within the following region: QQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPTHHPTVIVPAPAPPSSHH |
TFAP4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TFAP4 |
TFAP4 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic Peptide of human TFAP4 |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
