Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-TFDP1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFDP1 |
Rabbit Polyclonal Anti-Tfdp1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tfdp1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NLSPGKGVVSLVAVHPSTVNTLGKQLLPKTFGQSNVNITQQVVIGTPQRP |
Rabbit Polyclonal Anti-TFDP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFDP1 Antibody: A synthesized peptide derived from human TFDP1 |
Rabbit Polyclonal Anti-TFDP1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the N terminal of human TFDP1. Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN |
Anti-TFDP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.13~17(E-L-K-V-F) derived from Human DP-1 |
Rabbit Polyclonal Anti-TFDP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the middle region of human TFDP1. Synthetic peptide located within the following region: FSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDE |
Rabbit Polyclonal Anti-TFDP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the middle region of human TFDP1. Synthetic peptide located within the following region: SASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDED |
Rabbit Polyclonal Anti-TFDP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TFDP1 |
DP1/TFDP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human DP1/DP1/TFDP1 (NP_009042.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TFDP1