Rabbit Polyclonal Anti-TFDP3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFDP3 antibody: synthetic peptide directed towards the middle region of human TFDP3. Synthetic peptide located within the following region: ASDLTNIAIGMLATSSGGSQYSGSRVETPAVEEEEEEDNNDDDLSENDED |
Rabbit Polyclonal Anti-TFDP3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFDP3 antibody: synthetic peptide directed towards the N terminal of human TFDP3. Synthetic peptide located within the following region: PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE |
Rabbit polyclonal TFDP3 Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TFDP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-108 amino acids from the N-terminal region of human TFDP3. |
Rabbit Polyclonal Anti-TFDP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFDP3 antibody: synthetic peptide directed towards the middle region of human TFDP3. Synthetic peptide located within the following region: QSELQQLILQQIAFKNLVLRNQYVEEQVSQRPLPNSVIHVPFIIISSSKK |
Germany
Japan
United Kingdom
China