Germany
Japan
United Kingdom
China
Rabbit anti-TGM3 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TGM3 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TGM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGM3 antibody: synthetic peptide directed towards the N terminal of human TGM3. Synthetic peptide located within the following region: MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS |
Transglutaminase 3 (TGM3) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Immunogen | Recombinant Human epidermal Transglutaminase [TGe] |
Transglutaminase 3 (TGM3) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Immunogen | Recombinant Human epidermal Transglutaminase [TGe] |
Goat Polyclonal Antibody against Transglutaminase 3 (aa598-610)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLEVLNEARVRKP, from the internal region of the protein sequence according to NP_003236.3. |
TGM3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TGM3 |
TGM3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TGM3 |
Active filters
Target Symbol
- TGM3