Rabbit Polyclonal Anti-THAP5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THAP5 antibody: synthetic peptide directed towards the middle region of human THAP5. Synthetic peptide located within the following region: TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF |
Carrier-free (BSA/glycerol-free) THAP5 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
THAP5 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
THAP5 mouse monoclonal antibody,clone OTI2D7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
THAP5 mouse monoclonal antibody,clone OTI2D7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
THAP5 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China