Rabbit Polyclonal Anti-Thg1l Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thg1l antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF |
Rabbit Polyclonal Anti-THG1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THG1L antibody: synthetic peptide directed towards the middle region of human THG1L. Synthetic peptide located within the following region: DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY |
THG1L Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human THG1L |
THG1L rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human THG1L |
Germany
Japan
United Kingdom
China
