Antibodies

View as table Download

Goat Anti-TIAL1 & TIA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SPEITTEDIKSAFAP, from the internal region of the protein sequence according to NP_003243.1; NP_001029097.1.

Rabbit Polyclonal Anti-TIAL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TIAL1 antibody: synthetic peptide directed towards the C terminal of human TIAL1. Synthetic peptide located within the following region: WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ

TIAL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TIAL1

TIAL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TIAL1

TIAL1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 266-375 of human TIAL1 (NP_003243.1).
Modifications Unmodified