Goat Anti-TIAL1 & TIA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SPEITTEDIKSAFAP, from the internal region of the protein sequence according to NP_003243.1; NP_001029097.1. |
Goat Anti-TIAL1 & TIA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SPEITTEDIKSAFAP, from the internal region of the protein sequence according to NP_003243.1; NP_001029097.1. |
Rabbit Polyclonal Anti-TIAL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TIAL1 antibody: synthetic peptide directed towards the C terminal of human TIAL1. Synthetic peptide located within the following region: WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ |
TIAL1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TIAL1 |
TIAL1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TIAL1 |
TIAL1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 266-375 of human TIAL1 (NP_003243.1). |
Modifications | Unmodified |