Germany
Japan
United Kingdom
China
Tiparp (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 270-300 amino acids from the C-terminal region of human Tiparp |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TIPARP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIPARP antibody: synthetic peptide directed towards the N terminal of human TIPARP. Synthetic peptide located within the following region: LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL |
Rabbit Polyclonal Anti-TIPARP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TIPARP |
TIPARP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human TIPARP (NP_056323.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TIPARP