Rabbit Polyclonal Anti-TLE4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLE4 antibody: synthetic peptide directed towards the N terminal of human TLE4. Synthetic peptide located within the following region: GAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPS |
Rabbit polyclonal anti-TLE4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TLE4. |
TLE4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 166-196 amino acids from the N-terminal region of human TLE4 |
TLE4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TLE4. |
Germany
Japan
United Kingdom
China
