Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-AES Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SHLPQQLKFTTSD-C, from the N Terminus of the protein sequence according to NP_945320.1; NP_001121.2; NP_945321.1. |
Rabbit Polyclonal Anti-Aes Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aes antibody is: synthetic peptide directed towards the N-terminal region of Mouse Aes. Synthetic peptide located within the following region: QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK |
Rabbit Polyclonal Anti-AES Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AES antibody: synthetic peptide directed towards the middle region of human AES. Synthetic peptide located within the following region: HKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQ |
Rabbit polyclonal Anti-Aes Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aes antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Aes. Synthetic peptide located within the following region: TPLPVGLQPPSLPAVSAGTGLLSLSALGSQTHLSKEDKNGHDGDTHQEDD |
Rabbit Polyclonal Anti-AES Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AES antibody: synthetic peptide directed towards the C terminal of human AES. Synthetic peptide located within the following region: GLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD |
Active filters
Target Symbol
- TLE5