Rabbit Polyclonal Anti-TLK1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLK1 antibody: synthetic peptide directed towards the middle region of human TLK1. Synthetic peptide located within the following region: RQIDEQQKLLEKYKERLNKCISMSKKLLIEKSTQEKLSSREKSMQDRLRL |
Rabbit Polyclonal Anti-TLK1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLK1 antibody: synthetic peptide directed towards the N terminal of human TLK1. Synthetic peptide located within the following region: ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG |
Rabbit polyclonal anti-TLK1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TLK1. |
Rabbit polyclonal anti-Tlk1 antibody
| Applications | WB |
| Reactivities | Chimpanzee, Human, Orang-Utan, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 737-751 of human Tlk1 (Tousled-like kinase) (isoform 1) protein. |
TLK1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TLK1 |
TLK1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TLK1 |
TLK1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human TLK1 (NP_036422.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China