Rabbit Polyclonal Anti-TLL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLL1 antibody is: synthetic peptide directed towards the C-terminal region of Human TLL1. Synthetic peptide located within the following region: DASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWL |
TLL1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TLL1 |
TLL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TLL1 |
TLL1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TLL1 |
Germany
Japan
United Kingdom
China
