Rabbit Polyclonal TLR6 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TLR6 antibody was raised against a peptide corresponding to 13 amino acids near the center of human TLR6. |
Rabbit Polyclonal TLR6 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TLR6 antibody was raised against a peptide corresponding to 13 amino acids near the center of human TLR6. |
Rabbit Polyclonal TLR6 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TLR6 antibody was raised against a peptide corresponding to 15 amino acids near the amino terminus of human TLR6. |
Rabbit Polyclonal anti-TLR6 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT |
Mouse Monoclonal TLR6 Antibody (86B1153.2)
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal TLR6 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Within the range of amino acids 25-56 of human TLR6 protein were used as the immunogen. |
Rabbit Polyclonal Anti-TLR6 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TLR6 |
Rabbit Polyclonal Anti-TLR6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TLR6 |
TLR6 rabbit polyclonal antibody
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TLR6 |
TLR6 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 32-200 of human TLR6 (NP_006059.2). |
| Modifications | Unmodified |
Toll-Like Receptor 6 Rabbit polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of TLR6 |