Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TLR9 (N-term) goat polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Hamster, Mouse |
| Immunogen | Synthetic peptide LSLKYNNLTKVPRQLPPSLEY-C corresponding to amino acids 204-224 of the N-terminal domain of mouse TLR9 |
Rat Anti-Human CD289 (TLR9) Purified (25 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rat Anti-Mouse CD289 (TLR9) Purified (25 ug)
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TLR9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TLR9 Antibody: synthetic peptide directed towards the N terminal of human TLR9. Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN |
TLR9 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TLR9 |
TLR9 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TLR9 (NP_059138.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TLR9