Antibodies

Jump to Filters
View as table Download
TLX2 Rabbit Polyclonal Antibody
TA345195

USD 410.00

5 Days

Rabbit Polyclonal Anti-TLX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLX2 antibody: synthetic peptide directed towards the C terminal of human TLX2. Synthetic peptide located within the following region: QQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV
TLX2 Rabbit Polyclonal Antibody
TA345194

USD 475.00

5 Days

Rabbit Polyclonal Anti-TLX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLX2 antibody: synthetic peptide directed towards the N terminal of human TLX2. Synthetic peptide located within the following region: MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAF
TLX2 Rabbit Polyclonal Antibody
TA319662

USD 430.00

5 Days

Rabbit Polyclonal TLX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLX2 antibody was raised against an 18 amino acid peptide near the amino terminus of human TLX2.