Tmco3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to the middle region of mouse Tmco3 |
Tmco3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to the middle region of mouse Tmco3 |
Rabbit Polyclonal Anti-TMCO3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMCO3 antibody: synthetic peptide directed towards the N terminal of human TMCO3. Synthetic peptide located within the following region: KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL |
Tmco3 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |