Rabbit Polyclonal Anti-TMED3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMED3 antibody: synthetic peptide directed towards the C terminal of human TMED3. Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS |
Rabbit Polyclonal Anti-TMED3 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMED3 |
TMED3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMED3 |
TMED3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-180 of human TMED3 (NP_031390.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China