Antibodies

Jump to Filters
View as table Download
TMEM107 Rabbit Polyclonal Antibody
TA326657

USD 430.00

5 Days

Rabbit Polyclonal TMEM107 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TMEM107 antibody was raised against a 19 amino acid peptide near the amino terminus of human TMEM107.
TMEM107 Rabbit Polyclonal Antibody
TA339611

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMEM107 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM107 antibody: synthetic peptide directed towards the N terminal of human TMEM107. Synthetic peptide located within the following region: VVITLFWSRDSNIQACLPLTFTPEEYDKQDIHPLPLCRLVAALSVTLGLF
TMEM107 Rabbit Polyclonal Antibody
TA367556

USD 380.00

4 Weeks

TMEM107 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TMEM107