Antibodies

View as table Download

Rabbit Polyclonal Anti-C20orf30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C20orf30 Antibody: synthetic peptide directed towards the C terminal of human C20orf30. Synthetic peptide located within the following region: KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD

Carrier-free (BSA/glycerol-free) C20orf30 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C20orf30 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C20orf30 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C20orf30 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C20orf30 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

C20orf30 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C20orf30 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

C20orf30 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C20orf30 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".