Antibodies

Jump to Filters
View as table Download
C10orf57 (TMEM254) Rabbit Polyclonal Antibody
TA372128

USD 380.00

4 Weeks

TMEM254 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TMEM254
C10orf57 (TMEM254) (C-term) Rabbit Polyclonal Antibody
AP50929PU-N

USD 450.00

2 Weeks

C10orf57 (TMEM254) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 105-123 amino acids from the C-terminal region of human CJ057
C10orf57 (TMEM254) Rabbit Polyclonal Antibody
TA339545

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMEM254 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C10orf57 antibody: synthetic peptide directed towards the middle region of human C10orf57. Synthetic peptide located within the following region: QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH