Rabbit Polyclonal Anti-C19orf6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C19orf6 antibody: synthetic peptide directed towards the N terminal of human C19orf6. Synthetic peptide located within the following region: SEHVEPAAPGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFK |
Rabbit Polyclonal Anti-C19ORF6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C19ORF6 antibody: synthetic peptide directed towards the middle region of human C19ORF6. Synthetic peptide located within the following region: YDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMARTSYLAAFAIM |
TMEM259 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C19ORF6 |
TMEM259 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C19ORF6 |
Germany
Japan
United Kingdom
China
