Antibodies

Jump to Filters
View as table Download
C15ORF27 (TMEM266) (C-term) Rabbit Polyclonal Antibody
AP50994PU-N

USD 450.00

2 Weeks

C15ORF27 (TMEM266) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 506-535 amino acids from the C-terminal region of human CO027
C15ORF27 (TMEM266) Rabbit Polyclonal Antibody
TA338818

USD 375.00

5 Days

Rabbit Polyclonal Anti-C15orf27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C15orf27 antibody: synthetic peptide directed towards the middle region of human C15orf27. Synthetic peptide located within the following region: EMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAA
C15ORF27 (TMEM266) Rabbit Polyclonal Antibody
TA338819

USD 375.00

5 Days

Rabbit Polyclonal Anti-C15orf27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C15orf27 antibody: synthetic peptide directed towards the middle region of human C15orf27. Synthetic peptide located within the following region: PAGSAQTSPELEHRVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFRS