Antibodies

Jump to Filters
View as table Download
Transmembrane protein 30A (TMEM30A) Rabbit Polyclonal Antibody
TA342365

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMEM30A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM30A antibody is: synthetic peptide directed towards the middle region of Human TMEM30A. Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC