Rabbit Polyclonal Anti-TMEM91 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMEM91 Antibody: synthetic peptide directed towards the N terminal of human TMEM91. Synthetic peptide located within the following region: MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL |
Rabbit Polyclonal Anti-TMEM91 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMEM91 Antibody: synthetic peptide directed towards the N terminal of human TMEM91. Synthetic peptide located within the following region: SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV |
Germany
Japan
United Kingdom
China