Antibodies

Jump to Filters
View as table Download
TMIGD3 Rabbit Polyclonal Antibody
TA342792

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADORA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADORA3 antibody: synthetic peptide directed towards the C terminal of human ADORA3. Synthetic peptide located within the following region: RSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQRNRRV
TMIGD3 Rabbit Polyclonal Antibody
TA342793

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADORA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADORA3 antibody: synthetic peptide directed towards the C terminal of human ADORA3. Synthetic peptide located within the following region: DFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILI