Rabbit anti-TMPO Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TMPO |
Rabbit anti-TMPO Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TMPO |
Rabbit Polyclonal Thymopoietin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Thymopoietin antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human Thymopoietin. |
LAP2 (TMPO) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 165-195 amino acids from the N-terminal region of human TMPO |
Rabbit Polyclonal Anti-TMPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR |
Rabbit Polyclonal Anti-TMPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP |
Rabbit Polyclonal Anti-TMPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the middle region of human TMPO. Synthetic peptide located within the following region: EKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKI |
TMPO Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TMPO |