Germany
Japan
United Kingdom
China
Antibodies
View as table Download
LAP2 (TMPO) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 165-195 amino acids from the N-terminal region of human TMPO |
Rabbit Polyclonal Anti-TMPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR |
Rabbit Polyclonal Anti-TMPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP |
Rabbit Polyclonal Anti-TMPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the middle region of human TMPO. Synthetic peptide located within the following region: EKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKI |
TMPO Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TMPO |
Active filters
Target Symbol
- TMPO