Antibodies

View as table Download

Rabbit anti-TMPO Polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Thymopoietin Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Thymopoietin antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human Thymopoietin.

LAP2 (TMPO) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 165-195 amino acids from the N-terminal region of human TMPO

Rabbit Polyclonal Anti-TMPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR

Rabbit Polyclonal Anti-TMPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the N terminal of human TMPO. Synthetic peptide located within the following region: PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRP

Rabbit Polyclonal Anti-TMPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPO Antibody: synthetic peptide directed towards the middle region of human TMPO. Synthetic peptide located within the following region: EKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKI

TMPO Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TMPO