Antibodies

View as table Download

Rabbit Polyclonal TMPRSS11E Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

TMPRSS11E (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 248-277 amino acids from the Central region of human TMPRSS11E

Rabbit Polyclonal Anti-TMPRSS11E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPRSS11E antibody is: synthetic peptide directed towards the N-terminal region of Human TMPRSS11E. Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE

Rabbit Polyclonal Anti-TMPRSS11E Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS11E

TMPRSS11E rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS11E