Antibodies

View as table Download

Goat Anti-TMPRSS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DSTRCNADDAYQGE, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1.

Goat Anti-TMPRSS4 (aa245-57) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence HCFRKHTDVFNWK, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1.

Rabbit polyclonal Anti-TMPRSS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the N terminal of human TMPRSS4. Synthetic peptide located within the following region: IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT

Rabbit polyclonal Anti-TMPRSS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the middle region of human TMPRSS4. Synthetic peptide located within the following region: LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS

Rabbit Polyclonal Anti-TMPRSS4 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TMPRSS4 antibody was raised against synthetic 19 amino acid peptide from internal region of human TMPRSS4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Marmoset (100%); Gorilla, Orangutan (95%); Dog, Horse (89%); Hamster, Elephant, Panda, Pig (84%).

Rabbit Polyclonal Anti-TMPRSS4 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen TMPRSS4 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human TMPRSS4. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Orangutan, Gibbon (94%); Gorilla, Monkey (89%); Marmoset, Dog (83%).

Rabbit Polyclonal Anti-TMPRSS4 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen TMPRSS4 antibody was raised against synthetic 16 amino acid peptide from internal region of human TMPRSS4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Marmoset (100%); Mouse, Guinea pig (94%); Rat, Elephant, Panda, Bovine, Horse, Rabbit, Pig, Opossum (88%); Galago, Hamster, Dog, Platypus (81%).

Rabbit Polyclonal Anti-TMPRSS4 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TMPRSS4 antibody was raised against synthetic 19 amino acid peptide from internal region of human TMPRSS4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant (95%); Panda, Dog, Horse, Pig (89%).

Rabbit Polyclonal Anti-TMPRSS4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS4

TMPRSS4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS4

TMPRSS4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 70-270 of human TMPRSS4 (NP_063947.1).
Modifications Unmodified