Antibodies

View as table Download

TNFAIP2 rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 456-484 amino acids from the Central region of Human TNFAIP2.

Rabbit polyclonal anti-TNAP2 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNAP2.

Rabbit Polyclonal TNFAIP2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TNFAIP2 antibody was raised against a 19 amino acid synthetic peptide near the center of human TNFAIP2.

Rabbit Polyclonal Anti-TNFAIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNFAIP2 antibody is: synthetic peptide directed towards the N-terminal region of Human TNFAIP2. Synthetic peptide located within the following region: EAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQGLDG

Rabbit Polyclonal Anti-TNFAIP2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFAIP2

TNFAIP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFAIP2