Rabbit anti-TNF-R1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
Rabbit anti-TNF-R1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Biotinylated Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
TNFRSF1A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone TBP
| Applications | ELISA, LMNX |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700021 |
TNFRSF1A (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human TNFRSF1A |
TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Goat, Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211). |
TNFRSF1A (20-43) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Immunogen | TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1. |
Rabbit polyclonal TNF Receptor-1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
TNFRSF1A rabbit polyclonal antibody, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 259-288 amino acids from human TNFR |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Goat Anti-TNFRSF1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SDHEIDRLELQNGR, from the internal region of the protein sequence according to NP_001056.1. |
Rabbit Polyclonal Anti-TNF-R1 Antibody
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
USD 399.00
In Stock
TNFRSF1A biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone H398
| Applications | ELISA, LMNX |
| Reactivities | Human |
| Conjugation | Biotin |
| Matched ELISA Pair | TA600021 |