Antibodies

View as table Download

ABIN3 (TNIP3) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal ABIN3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ABIN3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human ABIN3.

Rabbit Polyclonal Anti-TNIP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNIP3 antibody is: synthetic peptide directed towards the N-terminal region of Human TNIP3. Synthetic peptide located within the following region: YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL

Rabbit Polyclonal Anti-TNIP3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNIP3

TNIP3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TNIP3