ABIN3 (TNIP3) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
ABIN3 (TNIP3) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal ABIN3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ABIN3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human ABIN3. |
Rabbit Polyclonal Anti-TNIP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNIP3 antibody is: synthetic peptide directed towards the N-terminal region of Human TNIP3. Synthetic peptide located within the following region: YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL |
Rabbit Polyclonal Anti-TNIP3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNIP3 |
TNIP3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TNIP3 |