Rabbit Polyclonal Anti-TNRC6B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNRC6B antibody: synthetic peptide directed towards the N terminal of human TNRC6B. Synthetic peptide located within the following region: FGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSGN |
Rabbit Polyclonal Anti-TNRC6B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNRC6B antibody: synthetic peptide directed towards the N terminal of human TNRC6B. Synthetic peptide located within the following region: LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG |
TNRC6B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TNRC6B |
Germany
Japan
United Kingdom
China