Germany
Japan
United Kingdom
China
TOE1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 89-117 amino acids from the N-terminal region of human TOE1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Toe1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Toe1 antibody: synthetic peptide directed towards the middle region of mouse Toe1. Synthetic peptide located within the following region: QSQPGTQTLAEAEDGPPTKQVCEDSLETEKMEQKVAEGEAGDQPGSREGH |
Rabbit Polyclonal Anti-TOE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOE1 antibody: synthetic peptide directed towards the N terminal of human TOE1. Synthetic peptide located within the following region: VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY |
TOE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TOE1 |
Active filters
Target Symbol
- TOE1