Antibodies

Jump to Filters
View as table Download
Topoisomerase II beta (TOP2B) Rabbit Polyclonal Antibody
TA314637

USD 345.00

4 Weeks

Rabbit polyclonal Topoisomerase II beta antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human topoisomerase II β.
Topoisomerase II beta (TOP2B) Rabbit Polyclonal Antibody
TA310135

USD 230.00

3 Weeks

Rabbit anti-TOP2B polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
Topoisomerase II beta (TOP2B) Rabbit Polyclonal Antibody
TA332226

USD 375.00

5 Days

Rabbit Polyclonal Anti-TOP2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TOP2B Antibody: synthetic peptide directed towards the middle region of human TOP2B. Synthetic peptide located within the following region: FGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVA
Topoisomerase II beta (TOP2B) Rabbit Polyclonal Antibody
TA335182

USD 375.00

5 Days

Rabbit Polyclonal Anti-TOP2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOP2B antibody: synthetic peptide directed towards the middle region of human TOP2B. Synthetic peptide located within the following region: ENEGDYNPGRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGR
Topoisomerase II beta (TOP2B) Rabbit Polyclonal Antibody
TA351833

USD 345.00

In Stock

Rabbit Polyclonal Anti-TOP2B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TOP2B