Antibodies

View as table Download

Rabbit Polyclonal TOX Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TOX antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human TOX.

Rabbit Polyclonal Anti-TOX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOX antibody: synthetic peptide directed towards the N terminal of human TOX. Synthetic peptide located within the following region: CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP

TOX Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human TOX