Rabbit Polyclonal TOX Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TOX antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human TOX. |
Rabbit Polyclonal TOX Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TOX antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human TOX. |
Rabbit Polyclonal Anti-TOX Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TOX antibody: synthetic peptide directed towards the N terminal of human TOX. Synthetic peptide located within the following region: CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP |
TOX Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TOX |