Rabbit Polyclonal Anti-TOX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TOX4 antibody is: synthetic peptide directed towards the C-terminal region of Human TOX4. Synthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV |
Rabbit Polyclonal Anti-KIAA0737 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIAA0737 antibody: synthetic peptide directed towards the N terminal of human KIAA0737. Synthetic peptide located within the following region: MEFPGGNDNYLTITGPSHPFLSGAETFHTPSLGDEEFEIPPISLDSDPSL |
Germany
Japan
United Kingdom
China