Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TP53I3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53I3 antibody is: synthetic peptide directed towards the C-terminal region of Human TP53I3. Synthetic peptide located within the following region: SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL |
Carrier-free (BSA/glycerol-free) TP53I3 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TP53I3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TP53I3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 163-332 of human TP53I3 (NP_671713.1). |
| Modifications | Unmodified |
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- TP53I3